Exenatide Acetate CAS NO.141732-76-5 , 141758-74-9

Original
price: Negotiable
minimum:
Total supply:
Delivery term: The date of payment from buyers deliver within days
seat: Zhejiang
Validity to: Long-term effective
Last update: 2019-09-18 12:52
Browse the number: 319
inquiry
Company Profile
 
 
Product details

Product Name

Exenatide Acetate

Synonyms

Exendin-4;Exenatide;Exenatide-d5;PC-DAC

CAS No.

141732-76-5, 141758-74-9 (net)

Catalog No.

GT-B004

Sequence(3-letter code)

H-His-Gly-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Leu-Ser-
Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-
Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-
Ala-Pro-Pro-Pro-Ser-NH2

Sequence(1-letter code)

HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2

Molecular Structure

Molecular Formula

C184H282N50O60S

Molecular Weight

4186.66

Key Specification

Appearance: White powder
Purity (HPLC) ≥98.0%
Acetate Content(HPLC): 5.0%~12.0%
Water Content (Karl Fischer) ≤10.0%
Bacterial endotoxin ≤5EU/mg

Package

1g, 5g, 10g, 20g, 50g, 100g.

Description

Exenatide is a glucagon-like peptide-1 (GLP-1) analog. It functions to activate the GLP-1 receptor and increases insulin secretion, decrease glucagon secretion, and slow gastric emptying to improve glycemic control

Storage

Keep cool & dry place(Store at -20°C, away from the light)

Remark

For Research Use Only. Not for human use.


http://www.gtpeptide.com/

Total0bar [View All]  Related Comments
 
more»Other products

[ Products search ] [ favorites ] [ Tell friends ] [ Print ] [ Close ]